Anti TNRC18 pAb (ATL-HPA024251)
Atlas Antibodies
- Catalog No.:
- ATL-HPA024251-25
- Shipping:
- Calculated at Checkout
$423.00
Gene Name: TNRC18
Alternative Gene Name: CAGL79, KIAA1856, TNRC18A
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039477: 84%, ENSRNOG00000024482: 81%
Entrez Gene ID: 84629
Uniprot ID: O15417
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | REGKHKRAAKTRKMEVGFKARGQPKSAHSPFASEVSSYSYNTDSEEDEEFLKDEWPAQGPSSSKLTPSLLCSMVAKNSKAAGGPKLTKRGLAAPRTLKPKPATSRKQPFCLLLREAEARSSFSDSSEESFDQDE |
| Gene Sequence | REGKHKRAAKTRKMEVGFKARGQPKSAHSPFASEVSSYSYNTDSEEDEEFLKDEWPAQGPSSSKLTPSLLCSMVAKNSKAAGGPKLTKRGLAAPRTLKPKPATSRKQPFCLLLREAEARSSFSDSSEESFDQDE |
| Gene ID - Mouse | ENSMUSG00000039477 |
| Gene ID - Rat | ENSRNOG00000024482 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti TNRC18 pAb (ATL-HPA024251) | |
| Datasheet | Anti TNRC18 pAb (ATL-HPA024251) Datasheet (External Link) |
| Vendor Page | Anti TNRC18 pAb (ATL-HPA024251) at Atlas Antibodies |
| Documents & Links for Anti TNRC18 pAb (ATL-HPA024251) | |
| Datasheet | Anti TNRC18 pAb (ATL-HPA024251) Datasheet (External Link) |
| Vendor Page | Anti TNRC18 pAb (ATL-HPA024251) |