Anti TMOD4 pAb (ATL-HPA028203 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA028203-25

Protein Description: tropomodulin 4 (muscle)
Gene Name: TMOD4
Alternative Gene Name: Sk-Tmod
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000005628: 97%, ENSRNOG00000021088: 97%
Entrez Gene ID: 29765
Uniprot ID: Q9NZQ9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MSNKQYYDALCSGEICNTEGISSVVQPDKYKPVPDEPPNPTNIEEILKRVRSNDKELEEVNL
• Gene Sequence: MSNKQYYDALCSGEICNTEGISSVVQPDKYKPVPDEPPNPTNIEEILKRVRSNDKELEEVNL
• Gene ID - Mouse: ENSMUSG00000005628
• Gene ID - Rat: ENSRNOG00000021088
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.