Research Area - Immunology & Inflammation - Labeled Proteins - Cosmo Bio USA
Close

Site Information

  • IKK epsilon [GST-tagged]

    Species Reactivity: human  Source: baculovirus expression vector system  Quality Control Protein Identification: Confirmed by mass spectrometry...

  • Optineurin (D474N) [GST-tagged]

    Species Reactivity: human  Source: E.coli  Formula: 50 mM HEPES pH 7.5, 150 mM sodium chloride, 2 mM dithiothreitol, 10% glycerol  Concentration: 0.5 mg/ml  Molecular Weight: 92...

  • Optineurin [GST-tagged]

    Species Reactivity: human  Source: E.coli  Formula: 50 mM HEPES pH 7.5, 150 mM sodium chloride, 2 mM dithiothreitol, 10% glycerol  Concentration: 0.5mg/ml  Molecular Weight: 92...

  • PKB alpha (S473D) [6His-tagged]

    Species Reactivity: human  Source: baculovirus expression vector system  Quality Control Protein Identification: Confirmed by mass spectrometry...

  • PKB alpha [GST-tagged]

    Species Reactivity: human  Source: E.coli  Quality Control Protein Identification: Confirmed by mass spectrometry...

  • S5a [GST-tagged]

    Species Reactivity: human  Source: E. coli  Formula: 50 mM HEPES pH 7.5, 150 mM sodium chloride, 2 mM dithiothreitol, 10% glycerol  Concentration: 0.5mg/ml  Molecular Weight: ~67...

  • TBK1 [GST-tagged]

    Species Reactivity: Human  Source: Sf21 insect cell-baculovirus expression  Formula: 50 mM Tris/HCl pH 7.5, 0.1 mM EGTA, 150 mM NaCl, 270 mM sucrose, 0.03% Brij, 0.1% b-Mercapto-ethanol, 1 mM...

  • TOLLIP [GST-tagged]

    Species Reactivity: human  Source: E. coli  Formula: 50 mM HEPES pH 7.5, 150 mM sodium chloride, 2 mM dithiothreitol, 10% glycerol  Concentration: 0.5 mg/ml  Molecular Weight:...

  • Transthyretin(His-Tag)

    Recombinant Protein / Transthyretin (His-Tag)Sequence: MRGSHHHHHHGSGPTGTGESKCPLMVKVLDAVRGSPAINVAVHVFRKAADDTWEPFASGKTSESGELHGLTTEEEFVEGIYKVEIDTKSYWKALGISPFHEHAEVVFTANDSGPRRYTIA ALLSPYSYSTTAVVTNPKEWarning: Store at 4°C...