Research Area - Disease - Amyloidosis - Labeled Proteins - Cosmo Bio USA
Close

Site Information

  • Transthyretin(His-Tag)

    Recombinant Protein / Transthyretin (His-Tag)Sequence: MRGSHHHHHHGSGPTGTGESKCPLMVKVLDAVRGSPAINVAVHVFRKAADDTWEPFASGKTSESGELHGLTTEEEFVEGIYKVEIDTKSYWKALGISPFHEHAEVVFTANDSGPRRYTIA ALLSPYSYSTTAVVTNPKEWarning: Store at 4°C...